CAT# | AF1872 |
Sequence | ALWKNMLKGIGKLAGQAALGAVKTLVGAES |
Activity | Antibacterial |
Host Chemicals | Phyllomedusa distincta | Length | 30 | SwissProt ID | P83641 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2244 | Pelophylaxin-3 | Inquiry | ||
AF1916 | Mram 8 | Inquiry | ||
AF1831 | Hymenochirin-1Pb | Inquiry | ||
AF1127 | Alyteserin-1b | Inquiry | ||
AF1055 | PGLa-St2 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...