Home > Product > Antimicrobial Peptides > Dermaseptin DS VIII-like peptide

Antimicrobial Peptides

Dermaseptin DS VIII-like peptide

Price Inquiry
CAT#
AF2176
Sequence
ALWKTMLKKLGTVALHAGKAALGAAADTISQGA
Host Chemicals
Phyllomedusa burmeisteri
Length
33
Activity
Antibacterial, Antifungal, Antiprotozoal
SwissProt ID
P86280

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.