Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ALWKTMLKKLGTVALHAGKAALGAAADTISQ |
Activity | Antimicrobial |
Host Chemicals | Phyllomedusa sauvagei |
Length | 31 |
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.