- Home
- COVID-19
- Services
- Products
- Research Areas
- Company
- Resources
- Ordering
Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.
| CAT# | 10-101-159 |
| Explanation | Dulaglutide is a novel glucagon-like peptide-1 agonist (GLP-1) biologic drug consisting of a dipeptidyl peptidase-IV-protected GLP-1 analogue covalently linked to a human IgG4-Fc heavy chain by a small peptide linker. |
| Synonyms/Alias | LY2189265 |
| M.F/Formula | C2646H4044N704O836S18 |
| M.W/Mr. | 59669.8068 |
| Sequence | One Letter Code: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG Three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly |
| Labeling Target | Glucagon-like peptide-1 (GLP-1) receptor |
| Application | Dulaglutide is indicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus. |
| Activity | Agonist |
| Biological Activity | Dulaglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist that augments glucose-dependent insulin secretion, and slows gastric emptying. |
| Areas of Interest | Metabolic Disease |
| Functions | Transmembrane signaling receptor activity |
| Disease | Type 2 Diabetes |
| Target | GLP-1 Receptor |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
