Dulaglutide

Dulaglutide is a novel glucagon-like peptide-1 agonist (GLP-1) biologic drug consisting of a dipeptidyl peptidase-IV-protected GLP-1 analogue covalently linked to a human IgG4-Fc heavy chain by a small peptide linker.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Dulaglutide(CAS 923950-08-7)

CAT No: 10-101-159

CAS No:923950-08-7

Synonyms/Alias:GLP-1 moiety from Dulaglutide;923950-08-7;Dulaglutide;1197810-60-8;HPNPLWNTQBSMAJ-FBXRENMFSA-N;AT41896;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H221N37O49
M.W/Mr.
3314.6
Sequence
One Letter Code:HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
Three Letter Code:H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly-OH
Labeling Target
Glucagon-like peptide-1 (GLP-1) receptor
Application
Dulaglutide is indicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus.
Activity
Agonist
Biological Activity
Dulaglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist that augments glucose-dependent insulin secretion, and slows gastric emptying.
Areas of Interest
Metabolic Disease
Functions
Transmembrane signaling receptor activity
Target
GLP-1 Receptor

Dulaglutide is a synthetic peptide belonging to the class of glucagon-like peptide-1 (GLP-1) receptor agonists, engineered for its high affinity and stability in biochemical research contexts. Structurally, it comprises a GLP-1 analog covalently linked to a modified immunoglobulin Fc fragment, which confers extended half-life and resistance to enzymatic degradation. Its molecular design enables precise interrogation of GLP-1 receptor-mediated signaling pathways, making it a valuable probe for metabolic, endocrinological, and pharmacological studies. The unique properties of dulaglutide facilitate in-depth exploration of incretin biology, receptor-ligand interactions, and peptide engineering strategies in translational research settings.

Receptor pharmacology studies: Dulaglutide serves as a robust tool for dissecting the pharmacodynamics and pharmacokinetics of GLP-1 receptor activation in vitro and in vivo. By mimicking endogenous incretin activity, it enables researchers to characterize receptor binding affinities, downstream signaling cascades, and the modulation of cyclic AMP production. These studies are essential for understanding receptor specificity, agonist potency, and the molecular determinants of peptide-receptor interactions, supporting the rational design of next-generation GLP-1 analogs.

Metabolic pathway elucidation: As a GLP-1 receptor agonist, dulaglutide offers significant utility in mapping the regulatory networks governing glucose homeostasis and energy balance. Experimental models employing this peptide can reveal insights into insulinotropic mechanisms, pancreatic beta-cell function, and the modulation of glucagon secretion. Such investigations are critical for unraveling the complex interplay between hormonal signaling and metabolic regulation, advancing knowledge in diabetes research and metabolic syndrome biology.

Peptide engineering and stability assessment: The chimeric structure of dulaglutide—combining a GLP-1 analog with an Fc domain—provides a model system for evaluating strategies to enhance peptide stability and bioavailability. Researchers leverage its engineered properties to study the impact of molecular modifications on proteolytic resistance, pharmacokinetic profiles, and immunogenicity. These findings inform the rational development of long-acting peptide therapeutics and contribute to the broader field of protein engineering.

Cellular signaling analysis: Dulaglutide enables detailed investigation of intracellular signaling events downstream of GLP-1 receptor activation. By applying this peptide in cell-based assays, scientists can monitor second messenger dynamics, gene expression changes, and functional outcomes such as insulin secretion or cellular proliferation. These applications support the identification of novel signaling nodes and regulatory elements relevant to endocrine physiology and metabolic disease models.

Comparative efficacy and structure-function research: The availability of dulaglutide as a research-grade peptide allows for direct comparison with other incretin mimetics and GLP-1 receptor agonists. Such comparative studies are instrumental in delineating structure-activity relationships, evaluating differential receptor engagement, and benchmarking biological responses across analogs. These insights are invaluable for guiding the optimization of peptide-based research tools and informing future design of GLP-1-related compounds.

Long-term Storage Conditions
Soluble in DMSO
Shipping Condition
Room temperature
Organism
Human
InChI
InChI=1S/C149H221N37O49/c1-16-76(10)121(147(233)164-79(13)126(212)172-103(58-85-61-155-90-34-24-23-33-88(85)90)137(223)174-99(54-73(4)5)138(224)183-119(74(6)7)145(231)171-91(35-25-27-51-150)128(214)159-64-110(195)156-63-109(194)157-67-118(208)209)185-139(225)101(55-82-29-19-17-20-30-82)175-134(220)97(45-50-116(204)205)168-131(217)92(36-26-28-52-151)166-125(211)78(12)162-124(210)77(11)163-130(216)94(41-46-108(153)193)167-132(218)95(43-48-114(200)201)169-133(219)96(44-49-115(202)203)170-135(221)98(53-72(2)3)173-136(222)100(57-84-37-39-87(192)40-38-84)176-142(228)105(68-187)179-144(230)107(70-189)180-146(232)120(75(8)9)184-141(227)104(60-117(206)207)177-143(229)106(69-188)181-149(235)123(81(15)191)186-140(226)102(56-83-31-21-18-22-32-83)178-148(234)122(80(14)190)182-112(197)66-160-129(215)93(42-47-113(198)199)165-111(196)65-158-127(213)89(152)59-86-62-154-71-161-86/h17-24,29-34,37-40,61-62,71-81,89,91-107,119-123,155,187-192H,16,25-28,35-36,41-60,63-70,150-152H2,1-15H3,(H2,153,193)(H,154,161)(H,156,195)(H,157,194)(H,158,213)(H,159,214)(H,160,215)(H,162,210)(H,163,216)(H,164,233)(H,165,196)(H,166,211)(H,167,218)(H,168,217)(H,169,219)(H,170,221)(H,171,231)(H,172,212)(H,173,222)(H,174,223)(H,175,220)(H,176,228)(H,177,229)(H,178,234)(H,179,230)(H,180,232)(H,181,235)(H,182,197)(H,183,224)(H,184,227)(H,185,225)(H,186,226)(H,198,199)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H,208,209)/t76-,77-,78-,79-,80+,81+,89-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,119-,120-,121-,122-,123-/m0/s1
InChI Key
HPNPLWNTQBSMAJ-FBXRENMFSA-N
BoilingPoint
N/A
References

Dulaglutide and liraglutide, both glucagon-like peptide-1 (GLP-1) receptor agonists, improve glycaemic control and reduce weight in patients with type 2 diabetes. In a head-to-head trial, we compared the safety and efficacy of once-weekly dulaglutide with that of once-daily liraglutide in metformin-treated patients with uncontrolled type 2 diabetes.

Once-weekly dulaglutide versus once-daily liraglutide in metformin-treated patients with type 2 diabetes (AWARD-6): a randomised, open-label, phase 3, non-inferiority trial

To compare efficacy and safety of dulaglutide, a once weekly glucagon-like peptide1 receptor agonist, to placebo and exenatide in type 2 diabetes patients. Primary objective was superiority of dulaglutide 1.5 mg versus placebo in HbA1c change at 26 weeks.

Efficacy and Safety of Dulaglutide Added on to Pioglitazone and Metformin Versus Exenatide in Type 2 Diabetes in a Randomized Controlled Trial (AWARD-1)

Melting Point
N/A

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide Modification ServicesPeptide Analysis ServicesPeptide CDMOEpitope Mapping ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers