Dulaglutide

Dulaglutide is a novel glucagon-like peptide-1 agonist (GLP-1) biologic drug consisting of a dipeptidyl peptidase-IV-protected GLP-1 analogue covalently linked to a human IgG4-Fc heavy chain by a small peptide linker.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Dulaglutide(CAS 923950-08-7)

CAT No: 10-101-159

CAS No:923950-08-7

Synonyms/Alias:GLP-1 moiety from Dulaglutide;923950-08-7;Dulaglutide;1197810-60-8;HPNPLWNTQBSMAJ-FBXRENMFSA-N;AT41896;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H221N37O49
M.W/Mr.
3314.6
Sequence
One Letter Code:HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
Three Letter Code:H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly-OH
Labeling Target
Glucagon-like peptide-1 (GLP-1) receptor
Application
Dulaglutide is indicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus.
Activity
Agonist
Biological Activity
Dulaglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist that augments glucose-dependent insulin secretion, and slows gastric emptying.
Areas of Interest
Metabolic Disease
Functions
Transmembrane signaling receptor activity
Target
GLP-1 Receptor

Dulaglutide, a synthetic glucagon-like peptide-1 (GLP-1) receptor agonist, represents a significant advancement in peptide-based research compounds. Engineered to mimic endogenous GLP-1, dulaglutide features a fusion of GLP-1 analog with a modified immunoglobulin fragment, which enhances its resistance to enzymatic degradation and extends its half-life in experimental settings. Its unique structure allows for sustained receptor activation, providing a reliable tool for the exploration of metabolic pathways and peptide-receptor interactions. Researchers value dulaglutide for its stability, bioactivity, and the ability to modulate key physiological processes, making it an indispensable resource in the study of metabolic regulation and peptide therapeutics.

Metabolic Research: In metabolic research, dulaglutide serves as a model compound for investigating the mechanisms underlying glucose homeostasis and energy balance. By activating GLP-1 receptors on pancreatic beta cells, it stimulates insulin secretion in a glucose-dependent manner, offering insights into the regulation of blood glucose levels. Experimental studies utilize dulaglutide to dissect signaling cascades, such as cAMP production and downstream gene expression, that are crucial for understanding metabolic disorders. Its application extends to the analysis of appetite regulation, energy expenditure, and the interplay between incretin hormones and nutrient metabolism, providing a comprehensive platform for metabolic investigations.

Peptide Drug Development: In the field of peptide drug development, dulaglutide is frequently employed as a reference molecule for the design and optimization of next-generation GLP-1 receptor agonists. Its structural modifications, including the fusion to an Fc fragment, inform strategies to improve peptide stability and pharmacokinetics. Researchers use dulaglutide as a benchmark in preclinical models to evaluate the efficacy, receptor binding affinity, and duration of action of new peptide analogs. Comparative studies help identify critical structural features that enhance therapeutic potential, guiding the rational design of innovative peptide-based agents.

Molecular Pharmacology: Dulaglutide is a valuable tool in molecular pharmacology for elucidating the dynamics of GLP-1 receptor signaling. Its well-characterized mechanism of action allows for the detailed study of receptor activation, desensitization, and internalization processes. By employing dulaglutide in cell-based assays, scientists can map signaling networks, assess receptor-ligand interactions, and investigate the effects of receptor modulation on cellular responses. These studies contribute to a deeper understanding of GPCR biology and support the development of targeted pharmacological interventions.

Obesity and Appetite Regulation Research: In obesity and appetite regulation research, dulaglutide offers a means to explore how GLP-1 receptor activation influences satiety and food intake. Experimental models utilize this peptide to examine neural and hormonal pathways involved in appetite suppression and body weight control. By modulating central and peripheral GLP-1 receptors, dulaglutide enables the dissection of mechanisms that govern feeding behavior, energy storage, and adiposity. Insights gained from these studies advance the knowledge of obesity pathophysiology and inform the development of novel interventions for weight management.

Cardiometabolic Studies: Cardiometabolic studies benefit from the application of dulaglutide to investigate the interconnectedness of glucose metabolism, lipid profiles, and vascular function. Researchers employ this GLP-1 receptor agonist to assess its effects on endothelial function, inflammation, and oxidative stress in experimental models. The compound's ability to modulate multiple metabolic and cardiovascular parameters provides a versatile tool for studying the complex relationships between metabolic health and cardiovascular risk. Such research supports the identification of new targets and pathways for improving cardiometabolic outcomes.

Dulaglutide's multifunctional profile ensures its continued relevance across diverse research domains. In addition to its established roles in metabolic research, peptide drug development, molecular pharmacology, obesity studies, and cardiometabolic investigations, it remains a subject of ongoing exploration for its impact on cellular signaling and systemic physiology. The breadth of its applications underscores the value of dulaglutide as a robust research tool, facilitating scientific progress and the discovery of novel therapeutic strategies in the field of peptide science.

Long-term Storage Conditions
Soluble in DMSO
Shipping Condition
Room temperature
Organism
Human
InChI
InChI=1S/C149H221N37O49/c1-16-76(10)121(147(233)164-79(13)126(212)172-103(58-85-61-155-90-34-24-23-33-88(85)90)137(223)174-99(54-73(4)5)138(224)183-119(74(6)7)145(231)171-91(35-25-27-51-150)128(214)159-64-110(195)156-63-109(194)157-67-118(208)209)185-139(225)101(55-82-29-19-17-20-30-82)175-134(220)97(45-50-116(204)205)168-131(217)92(36-26-28-52-151)166-125(211)78(12)162-124(210)77(11)163-130(216)94(41-46-108(153)193)167-132(218)95(43-48-114(200)201)169-133(219)96(44-49-115(202)203)170-135(221)98(53-72(2)3)173-136(222)100(57-84-37-39-87(192)40-38-84)176-142(228)105(68-187)179-144(230)107(70-189)180-146(232)120(75(8)9)184-141(227)104(60-117(206)207)177-143(229)106(69-188)181-149(235)123(81(15)191)186-140(226)102(56-83-31-21-18-22-32-83)178-148(234)122(80(14)190)182-112(197)66-160-129(215)93(42-47-113(198)199)165-111(196)65-158-127(213)89(152)59-86-62-154-71-161-86/h17-24,29-34,37-40,61-62,71-81,89,91-107,119-123,155,187-192H,16,25-28,35-36,41-60,63-70,150-152H2,1-15H3,(H2,153,193)(H,154,161)(H,156,195)(H,157,194)(H,158,213)(H,159,214)(H,160,215)(H,162,210)(H,163,216)(H,164,233)(H,165,196)(H,166,211)(H,167,218)(H,168,217)(H,169,219)(H,170,221)(H,171,231)(H,172,212)(H,173,222)(H,174,223)(H,175,220)(H,176,228)(H,177,229)(H,178,234)(H,179,230)(H,180,232)(H,181,235)(H,182,197)(H,183,224)(H,184,227)(H,185,225)(H,186,226)(H,198,199)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H,208,209)/t76-,77-,78-,79-,80+,81+,89-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,119-,120-,121-,122-,123-/m0/s1
InChI Key
HPNPLWNTQBSMAJ-FBXRENMFSA-N
BoilingPoint
N/A
References

Dulaglutide and liraglutide, both glucagon-like peptide-1 (GLP-1) receptor agonists, improve glycaemic control and reduce weight in patients with type 2 diabetes. In a head-to-head trial, we compared the safety and efficacy of once-weekly dulaglutide with that of once-daily liraglutide in metformin-treated patients with uncontrolled type 2 diabetes.

Once-weekly dulaglutide versus once-daily liraglutide in metformin-treated patients with type 2 diabetes (AWARD-6): a randomised, open-label, phase 3, non-inferiority trial

To compare efficacy and safety of dulaglutide, a once weekly glucagon-like peptide1 receptor agonist, to placebo and exenatide in type 2 diabetes patients. Primary objective was superiority of dulaglutide 1.5 mg versus placebo in HbA1c change at 26 weeks.

Efficacy and Safety of Dulaglutide Added on to Pioglitazone and Metformin Versus Exenatide in Type 2 Diabetes in a Randomized Controlled Trial (AWARD-1)

Melting Point
N/A

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Modification ServicesPeptide CDMOPeptide Analysis ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers