Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | DVQCGEGHFCHDQTCCRASQGGACCPYSQGVCCADQRHCCPVGF |
Activity | Antibacterial |
Host Chemicals | Equus caballus |
Length | 44 |
SwissProt ID | P80930 |
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.