Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN |
Activity | Gram+ & Gram-, |
Host Chemicals | Horse |
Length | 46 |
SwissProt ID | SwissProt ID: P56928 |
1. Cationic cell-penetrating peptides are potent furin inhibitors
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.