Keywords Search Google Search Search

Esculentin-2-OR5

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2633
Sequence	GVFTLIKGATQLIGKTLGKELGKTGLEIMACKITKQC
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF1592	CPF-P5	Inquiry
AF1766	Odorranain-F-RA1 peptide precursor	Inquiry
AF427	Lasioglossin LL-II	Inquiry
AF1042	PP13	Inquiry
AF262	Indolicidin Peptide Derivative With P-->a Substitution	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

β-secretase and γ-Secretase Inhibitors

Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Odorrana rotodora
Length	37