Exendin derivative 1

Exendin derivative 1 is a 39 amino acid peptide.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1346

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₈₄H₂₈₁N₄₉O₆₁S
M.W/Mr.
4187.56
Sequence
One Letter Code: HAEGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPSLMNPQRSTVWY
three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Leu-Met-Asn-Pro-Gln-Arg-Ser-Thr-Val-Trp-Tyr

Exendin derivative 1 is a synthetic peptide analog derived from the naturally occurring exendin family, which is structurally related to glucagon-like peptide-1 (GLP-1). As a member of the exendin peptide class, it exhibits a distinctive sequence and conformation that confer high affinity for GLP-1 receptors in vitro. Its biochemical relevance is underscored by its ability to modulate receptor-mediated signaling pathways, making it a valuable tool in peptide research focused on metabolic regulation, receptor pharmacology, and peptide engineering. The structural modifications present in Exendin derivative 1 offer enhanced stability and unique functional properties, supporting its utility in a variety of advanced biochemical investigations.

Peptide-receptor interaction studies: Exendin derivative 1 is extensively employed in research exploring the binding dynamics and activation mechanisms of GLP-1 receptors. By serving as a selective ligand in receptor-ligand binding assays, it enables the characterization of receptor specificity, affinity constants, and downstream signaling events. Detailed analysis of these interactions provides crucial insights into receptor activation, desensitization, and potential allosteric modulation, informing the design of next-generation peptide-based modulators.

Peptide engineering and structure-activity relationship (SAR) analysis: The unique sequence of this derivative allows researchers to dissect the structural determinants responsible for receptor engagement and biological activity. By systematically comparing Exendin derivative 1 with native exendin peptides and other analogs, investigators can map critical residues and conformational features that influence potency and selectivity. Such SAR studies are instrumental in guiding rational design strategies for novel peptide therapeutics and research probes.

Metabolic pathway elucidation: In cellular and biochemical models, Exendin derivative 1 is utilized to probe the signaling cascades initiated by GLP-1 receptor activation. Its application in metabolic research extends to the investigation of cAMP production, kinase activation, and gene expression changes associated with peptide hormone signaling. These studies help delineate the molecular underpinnings of metabolic regulation and energy homeostasis, supporting broader efforts in metabolic biochemistry and endocrinology.

Peptide stability and degradation profiling: The engineered modifications within Exendin derivative 1 make it a prime candidate for studies focused on peptide stability, proteolytic resistance, and degradation kinetics. By comparing its stability profile to that of unmodified exendin peptides, researchers can assess the impact of specific sequence alterations on peptide half-life and susceptibility to enzymatic cleavage. These findings are valuable for optimizing peptide formulations and delivery strategies in research settings.

Analytical method development: The defined physicochemical properties of Exendin derivative 1 render it suitable as a reference standard or model compound in the development and validation of analytical techniques. It is frequently used in high-performance liquid chromatography (HPLC), mass spectrometry, and immunoassay protocols to establish detection limits, calibration curves, and quantification methodologies for peptide analytes. Such applications are essential for ensuring the accuracy and reproducibility of peptide quantification in complex biological samples.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide CDMOEpitope Mapping ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide Analysis ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers