Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3863.3 |
Sequence | GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Length | 36 |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.