Keywords Search Google Search Search

Fowlicidin-2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2139
Sequence	LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF1223	Hcl-hst5	Inquiry
AF2885	ToAMP4	Inquiry
AF619	Antimicrobial peptide , immobilized peptide E18KGG	Inquiry
AF2445	Defensin-related cryptdin 2 precursor	Inquiry
AF916	Japonicin-2	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of JIP1 in Promoting Axonal Growth

JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

APETx2, A Kind of ASIC3 Channel Blocker

APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...

HERG-specific Peptide Toxin-BeKm 1

The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...

The effect of thymopentin in the treatment of chronic severe viral hepatitis B

The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Gallus gallus
Length	32