Home > Product > Antimicrobial Peptides > Gaegurin-6-RA peptide precursor

Antimicrobial Peptides

Gaegurin-6-RA peptide precursor

Price Inquiry
CAT#
AF3120
Sequence
TMKKSLLLIFFLGTINLSLCQEERNAEEEKRDGDDEMDAEVEKR
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
44
Activity
Antimicrobial
SwissProt ID
E3SYM7

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.