Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWALAAAGALGATAA |
Activity | Gram+ & Gram-, |
Host Chemicals | Lactobacillus gasseri LA39; Lactobacillus reuteri LA6 |
Length | 58 |
1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.