Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C140H226N44O41 |
M.W/Mr. | 3181.6 |
Sequence | One Letter Code: EKKEGHFSALPSLPVGSHAKVSSPQPRGPR Three Letter Code:H-Glu-Lys-Lys-Glu-Gly-His-Phe-Ser-Ala-Leu-Pro-Ser-Leu-Pro-Val-Gly-Ser-His-Ala-Lys-Val-Ser-Ser-Pro-Gln-Pro-Arg-Gly-Pro-Arg-OH |
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.