Keywords Search Google Search Search

Glicentin-Related Peptide (21-50), human

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	E10011
M.W/Mr.	3383.5
Sequence	RSLQDTEEKSRSFSASQADPLSDPDQMNED-NH2

CAT#	Product Name	Inquiry
E10004	Des His1, Glu8 Exendin-4	Inquiry
CAD-110	Endo-38a-Pro-Exenatide	Inquiry
E10012	Trp Cage	Inquiry
E10008	Exendin (4-39)	Inquiry
E10007	Exendin (10-39)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of M871 as a Galanin GAL2 Receptor Antagonist

Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...

MEN 11270, a peptide antagonist at the human B2 kinin receptor

MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...

What is peptide YY?

The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...

Obtustatin: a potent selective α1β1 inhibitor

Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...

The Function of Depreotide in Tumor Receptor Imaging

Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: