GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat)

GLP-1 (7-36)-Lys(biotinyl) amide trifluoroacetate salt contains a biotinylated lysine enabling affinity purification and detection. The conserved GLP-1 backbone supports receptor-binding studies across multiple species. Researchers use it to visualize ligand interactions and examine conformational changes. Its biotin tag allows sensitive tracking in immobilization and pull-down assays.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat)(CAS 1802086-70-9)

CAT No: G16036

CAS No:1802086-70-9

Synonyms/Alias:GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt;1802086-70-9;GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C165H252N44O48S
M.W/Mr.
3652.1
Sequence
One Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRX
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)(biotinyl)-NH2
InChI
InChI=1S/C165H252N44O48S/c1-17-85(10)132(161(254)184-89(14)140(233)193-114(68-95-71-176-100-40-25-24-39-98(95)100)151(244)195-110(64-82(4)5)152(245)205-130(83(6)7)159(252)192-102(42-28-31-59-166)142(235)177-73-123(218)185-103(44-34-62-175-164(171)172)146(239)187-101(136(170)229)41-30-33-61-174-122(217)46-27-26-45-120-135-119(79-258-120)203-165(257)209-135)207-153(246)112(65-92-35-20-18-21-36-92)196-148(241)108(54-58-128(225)226)191-147(240)104(43-29-32-60-167)188-138(231)87(12)181-137(230)86(11)183-145(238)107(51-55-121(169)216)186-124(219)74-178-144(237)106(53-57-127(223)224)190-149(242)109(63-81(2)3)194-150(243)111(67-94-47-49-97(215)50-48-94)197-156(249)116(76-210)200-158(251)118(78-212)201-160(253)131(84(8)9)206-155(248)115(70-129(227)228)198-157(250)117(77-211)202-163(256)134(91(16)214)208-154(247)113(66-93-37-22-19-23-38-93)199-162(255)133(90(15)213)204-125(220)75-179-143(236)105(52-56-126(221)222)189-139(232)88(13)182-141(234)99(168)69-96-72-173-80-180-96/h18-25,35-40,47-50,71-72,80-91,99,101-120,130-135,176,210-215H,17,26-34,41-46,51-70,73-79,166-168H2,1-16H3,(H2,169,216)(H2,170,229)(H,173,180)(H,174,217)(H,177,235)(H,178,237)(H,179,236)(H,181,230)(H,182,234)(H,183,238)(H,184,254)(H,185,218)(H,186,219)(H,187,239)(H,188,231)(H,189,232)(H,190,242)(H,191,240)(H,192,252)(H,193,233)(H,194,243)(H,195,244)(H,196,241)(H,197,249)(H,198,250)(H,199,255)(H,200,251)(H,201,253)(H,202,256)(H,204,220)(H,205,245)(H,206,248)(H,207,246)(H,208,247)(H,221,222)(H,223,224)(H,225,226)(H,227,228)(H4,171,172,175)(H2,203,209,257)/t85-,86-,87-,88-,89-,90+,91+,99-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,130-,131-,132-,133-,134-,135-/m0/s1
InChI Key
DVZRWUQLVWOAPV-PSQNHTQXSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Analysis ServicesPeptide Synthesis ServicesEpitope Mapping ServicesPeptide Modification ServicescGMP Peptide ServicePeptide CDMOPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers