GLP-2 (1-33) (human)

GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

Online Inquiry

CAT#R1865
CAS223460-79-5
Synonyms/AliasGlucagon-like peptide 2 (human)
M.F/FormulaC165H254N44O55S
M.W/Mr.3766.1
SequenceOne Letter Code: AGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Three Letter Code: His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Purity>98%
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.