Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled
Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled
Online Inquiry
| CAT# | G05009 |
| M.W/Mr. | 3841.1 |
| Sequence | FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G16011 |
([13C6]Leu14)-Glucagon (1-29) (human, rat, porcine) |
|
|
Inquiry |
| G16004 |
GLP-1 (7-36), amide, chicken, common turkey |
|
|
Inquiry |
| G16013 |
(Des-Thr5)-Glucagon |
|
|
Inquiry |
| G16032 |
GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human |
|
|
Inquiry |
| G16002 |
Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human |
|
|
Inquiry |
Write a review
Ask a question
My Review for Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled
Required fields are marked with *
×
Ask a Question for Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
