CAT# | G05009 |
M.W/Mr. | 3841.1 |
Sequence | FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...