Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3841.1 |
Sequence | FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
Length | 33 |
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Myotropic activity of allatostatins in tenebrionid beetles
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.