1. Home
  2. Products
  3. Therapeutic Peptides
  4. Peptide Inhibitors
  5. Glucagon-like peptide 1 (1-37), human

Glucagon-like peptide 1 (1-37), human

Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Glucagon-like peptide 1 (1-37), human(CAS 87805-34-3)

CAT No: R1386

CAS No:87805-34-3

Synonyms/Alias:87805-34-3;Glucagon-like peptide 1 (1-37);UNII-SQ6SA9L9XQ;Glp-I (1-37);DTXSID10236651;Glucagon-like peptide I (1-37);GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt;SQ6SA9L9XQ;DTXCID40159142;DA-53582;FG109540;GLP-1 (1-37);

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C186H275N51O59
M.W/Mr.
4169
Sequence
One Letter Code:HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Three Letter Code:H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
InChI
InChI=1S/C186H275N51O59/c1-17-94(10)149(182(294)209-98(14)155(267)220-128(73-105-78-199-111-42-28-27-41-109(105)111)171(283)223-123(68-91(4)5)173(285)234-147(92(6)7)180(292)219-113(43-29-31-63-187)158(270)200-81-136(245)210-112(45-33-65-197-185(191)192)157(269)203-84-146(262)263)236-174(286)126(70-102-37-23-19-24-38-102)225-165(277)120(55-61-142(254)255)216-162(274)114(44-30-32-64-188)212-153(265)96(12)206-152(264)95(11)207-161(273)118(51-57-135(190)244)211-137(246)82-201-160(272)117(53-59-140(250)251)215-168(280)122(67-90(2)3)222-170(282)125(72-104-47-49-108(243)50-48-104)226-177(289)132(85-238)230-179(291)134(87-240)231-181(293)148(93(8)9)235-176(288)131(77-145(260)261)228-178(290)133(86-239)232-184(296)151(100(16)242)237-175(287)127(71-103-39-25-20-26-40-103)229-183(295)150(99(15)241)233-138(247)83-202-159(271)116(52-58-139(248)249)213-154(266)97(13)208-167(279)129(75-107-80-196-89-205-107)227-163(275)115(46-34-66-198-186(193)194)214-164(276)119(54-60-141(252)253)217-169(281)124(69-101-35-21-18-22-36-101)224-166(278)121(56-62-143(256)257)218-172(284)130(76-144(258)259)221-156(268)110(189)74-106-79-195-88-204-106/h18-28,35-42,47-50,78-80,88-100,110,112-134,147-151,199,238-243H,17,29-34,43-46,51-77,81-87,187-189H2,1-16H3,(H2,190,244)(H,195,204)(H,196,205)(H,200,270)(H,201,272)(H,202,271)(H,203,269)(H,206,264)(H,207,273)(H,208,279)(H,209,294)(H,210,245)(H,211,246)(H,212,265)(H,213,266)(H,214,276)(H,215,280)(H,216,274)(H,217,281)(H,218,284)(H,219,292)(H,220,267)(H,221,268)(H,222,282)(H,223,283)(H,224,278)(H,225,277)(H,226,289)(H,227,275)(H,228,290)(H,229,295)(H,230,291)(H,231,293)(H,232,296)(H,233,247)(H,234,285)(H,235,288)(H,236,286)(H,237,287)(H,248,249)(H,250,251)(H,252,253)(H,254,255)(H,256,257)(H,258,259)(H,260,261)(H,262,263)(H4,191,192,197)(H4,193,194,198)/t94-,95-,96-,97-,98-,99+,100+,110-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,147-,148-,149-,150-,151-/m0/s1
InChI Key
UKVFVQPAANCXIL-FJVFSOETSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide Synthesis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide CDMOPeptide Analysis Services
Hot Products
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

Read More Read More
Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Read More Read More
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
Glucagon

Glucagon peptide promotes glycogen breakdown and blood sugar regulation. Buy Glucagon research peptide online for metabolic and liver studies.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) Acetate is a radiolabeled peptide for tumor imaging and targeting research. Purchase this high-purity peptide for oncology and diagnostic studies.

Read More Read More
GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Read More Read More
Thymosin β4 Acetate

Thymosin β4 Acetate promotes wound healing, tissue repair, and cell regeneration. Buy Thymosin beta 4 peptide powder for research on recovery and regenerative medicine.

Read More Read More
Angiotensin II

Angiotensin II peptide regulates blood pressure and vascular constriction. Purchase this synthetic research peptide to support cardiovascular and renal function studies.

Read More Read More
Argipressin

Argipressin peptide regulates water balance and blood pressure in biological systems. Shop pure Argipressin peptide online for cardiovascular and kidney research.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers