Glucagon-like peptide 1 (1-37), human

Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Glucagon-like peptide 1 (1-37), human(CAS 87805-34-3)

CAT No: R1386

CAS No:87805-34-3

Synonyms/Alias:87805-34-3;Glucagon-like peptide 1 (1-37);UNII-SQ6SA9L9XQ;Glp-I (1-37);DTXSID10236651;Glucagon-like peptide I (1-37);GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt;SQ6SA9L9XQ;DTXCID40159142;DA-53582;FG109540;GLP-1 (1-37);

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C186H275N51O59
M.W/Mr.
4169
Sequence
One Letter Code:HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Three Letter Code:H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH

Glucagon-like peptide 1 (1-37), human is a naturally occurring peptide hormone belonging to the incretin family, primarily recognized for its role in glucose metabolism and pancreatic function. Structurally, it is a 37-amino acid peptide derived from the proglucagon precursor, with significant sequence conservation across mammalian species. In the context of biochemical research, this full-length form of GLP-1 is of particular interest for elucidating the molecular mechanisms underlying hormone processing, receptor interactions, and the broader physiological roles of incretin peptides. Its unique sequence and bioactivity profile make it a valuable tool for studies focused on peptide hormone signaling, enzymatic cleavage processes, and the modulation of metabolic pathways in various model systems.

Peptide hormone signaling research: As a prototypical incretin, GLP-1 (1-37) serves as a critical model for investigating peptide hormone-receptor interactions, particularly with the GLP-1 receptor (GLP1R), a class B G protein-coupled receptor. Researchers utilize this peptide to map binding domains, characterize receptor activation dynamics, and study downstream signaling cascades such as cAMP production and protein kinase A activation. These insights contribute to a deeper understanding of how peptide hormones regulate cellular responses in pancreatic, neural, and gastrointestinal tissues.

Enzymatic processing studies: The full-length GLP-1 (1-37) is a key substrate for prohormone convertases and dipeptidyl peptidase-4 (DPP-4), enzymes responsible for generating shorter, bioactive fragments such as GLP-1 (7-36) amide. By providing the unprocessed peptide, researchers can dissect the kinetics and specificity of these proteolytic events in vitro, enabling the identification of processing intermediates and the characterization of enzyme-substrate interactions. Such studies are fundamental for understanding the regulation of peptide hormone activity and the physiological control of glucose homeostasis.

Metabolic pathway analysis: The availability of synthetic GLP-1 (1-37) supports investigations into the broader network of metabolic regulation mediated by proglucagon-derived peptides. By introducing this peptide into cultured cells or ex vivo tissue preparations, scientists can monitor shifts in gene expression, insulin secretion, and lipid metabolism, thereby clarifying the integrated roles of incretin hormones in energy balance. These experiments are instrumental in mapping metabolic cross-talk and identifying novel regulatory nodes within endocrine signaling pathways.

Peptide structure-function relationship studies: The full-length human GLP-1 sequence offers a platform for systematic mutagenesis and structure-activity relationship (SAR) experiments. Researchers can generate analogs or truncated variants to assess the contribution of specific amino acid residues or domains to receptor binding, biological activity, and resistance to enzymatic degradation. This approach is essential for unraveling the molecular determinants of peptide hormone function and for guiding the rational design of synthetic analogs with tailored properties for research purposes.

Analytical method development: GLP-1 (1-37) is frequently employed as a reference standard or calibration peptide in the development and validation of analytical techniques such as mass spectrometry, HPLC, and immunoassays. Its defined sequence and physicochemical properties make it suitable for optimizing peptide detection protocols, quantifying endogenous or synthetic peptide levels, and ensuring assay specificity. These applications are vital for advancing peptide quantification methodologies in both basic research and quality control settings.

InChI
InChI=1S/C186H275N51O59/c1-17-94(10)149(182(294)209-98(14)155(267)220-128(73-105-78-199-111-42-28-27-41-109(105)111)171(283)223-123(68-91(4)5)173(285)234-147(92(6)7)180(292)219-113(43-29-31-63-187)158(270)200-81-136(245)210-112(45-33-65-197-185(191)192)157(269)203-84-146(262)263)236-174(286)126(70-102-37-23-19-24-38-102)225-165(277)120(55-61-142(254)255)216-162(274)114(44-30-32-64-188)212-153(265)96(12)206-152(264)95(11)207-161(273)118(51-57-135(190)244)211-137(246)82-201-160(272)117(53-59-140(250)251)215-168(280)122(67-90(2)3)222-170(282)125(72-104-47-49-108(243)50-48-104)226-177(289)132(85-238)230-179(291)134(87-240)231-181(293)148(93(8)9)235-176(288)131(77-145(260)261)228-178(290)133(86-239)232-184(296)151(100(16)242)237-175(287)127(71-103-39-25-20-26-40-103)229-183(295)150(99(15)241)233-138(247)83-202-159(271)116(52-58-139(248)249)213-154(266)97(13)208-167(279)129(75-107-80-196-89-205-107)227-163(275)115(46-34-66-198-186(193)194)214-164(276)119(54-60-141(252)253)217-169(281)124(69-101-35-21-18-22-36-101)224-166(278)121(56-62-143(256)257)218-172(284)130(76-144(258)259)221-156(268)110(189)74-106-79-195-88-204-106/h18-28,35-42,47-50,78-80,88-100,110,112-134,147-151,199,238-243H,17,29-34,43-46,51-77,81-87,187-189H2,1-16H3,(H2,190,244)(H,195,204)(H,196,205)(H,200,270)(H,201,272)(H,202,271)(H,203,269)(H,206,264)(H,207,273)(H,208,279)(H,209,294)(H,210,245)(H,211,246)(H,212,265)(H,213,266)(H,214,276)(H,215,280)(H,216,274)(H,217,281)(H,218,284)(H,219,292)(H,220,267)(H,221,268)(H,222,282)(H,223,283)(H,224,278)(H,225,277)(H,226,289)(H,227,275)(H,228,290)(H,229,295)(H,230,291)(H,231,293)(H,232,296)(H,233,247)(H,234,285)(H,235,288)(H,236,286)(H,237,287)(H,248,249)(H,250,251)(H,252,253)(H,254,255)(H,256,257)(H,258,259)(H,260,261)(H,262,263)(H4,191,192,197)(H4,193,194,198)/t94-,95-,96-,97-,98-,99+,100+,110-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,147-,148-,149-,150-,151-/m0/s1
InChI Key
UKVFVQPAANCXIL-FJVFSOETSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Synthesis ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide CDMOEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers