Glucagon-like peptide 1 (7-36) amide (human, rat)

Glucagon-Like Peptide 1 (7-36) Amide is a potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Glucagon-like peptide 1 (7-36) amide (human, rat)(CAS 107444-51-9)

CAT No: 10-101-265

CAS No:107444-51-9

Synonyms/Alias:107444-51-9;Glucagon-like peptide-I(7-36) amide;Glucagon-like Peptide 1 (7-36) amide;GLP-1(7-36);GLP-1(7-36), amide;GLP-17-3;Insulinotropin (human);Rat GLP-I(7-36)amide;UNII-0JS9125PIZ;GLP-1 (7-36) amide;Glp-I (7-36);MKC 253;Glucagon-like peptide I (7-36);Glucagon-like peptide 1 (7-36);Human glucagon-like peptide-1-(7-36) amide;0JS9125PIZ;AKOS024456935;GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt;Glucagon-like Peptide-1 (7-36) Amide;DA-53583;FG109975;GLP-1-(7-36);TS-08934;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H226N40O45
M.W/Mr.
3297.6
Sequence
One Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Activity
Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Glucagon-like peptide 1 (7-36) amide (human, rat) is a synthetic peptide fragment that corresponds to the biologically active region of endogenous GLP-1, a key incretin hormone involved in metabolic regulation. This peptide is widely recognized for its ability to stimulate insulin secretion in a glucose-dependent manner and inhibit glucagon release, thereby modulating glucose homeostasis. Structurally, GLP-1 (7-36) amide is characterized by its amide modification at the C-terminus, which enhances its biological stability and mimics the natural form found in both humans and rats. Its high degree of conservation across species makes it an invaluable research tool for comparative physiological and pharmacological studies. The peptide's interaction with the GLP-1 receptor, a member of the class B G protein-coupled receptor family, triggers a cascade of intracellular signaling events that are essential for understanding the molecular basis of metabolic diseases. Researchers value this compound for its specificity, well-characterized mode of action, and its relevance to both basic and translational research in endocrinology and metabolism.

Metabolic Disease Modeling: Glucagon-like peptide 1 (7-36) amide is extensively utilized in preclinical models to investigate the pathophysiology of metabolic disorders, such as type 2 diabetes and obesity. By administering this peptide to animal models, scientists can study its effects on insulin secretion, glucose uptake, and overall energy balance. These experiments help elucidate the mechanisms by which GLP-1 modulates pancreatic beta cell function and peripheral glucose utilization. The ability to replicate the physiological actions of endogenous GLP-1 in both human and rat systems enables researchers to bridge findings across species, facilitating the development of novel therapeutic strategies and the identification of new drug targets.

Receptor Signaling Research: GLP-1 (7-36) amide serves as a powerful tool for dissecting the signaling pathways associated with the GLP-1 receptor. In cell-based assays, it is commonly used to stimulate receptor activation, allowing scientists to monitor downstream effects such as cyclic AMP production, protein kinase A activation, and changes in gene expression. These studies provide critical insights into the molecular interactions and regulatory mechanisms that govern incretin signaling. Furthermore, the peptide's specificity for the GLP-1 receptor makes it ideal for differentiating between receptor-mediated and non-receptor-mediated effects, thereby enhancing the accuracy and interpretability of experimental results.

Appetite and Satiety Regulation: The role of GLP-1 (7-36) amide in appetite control and satiety has garnered significant attention in neuroscience and behavioral research. When administered centrally or peripherally, the peptide has been shown to reduce food intake and influence feeding behavior in animal models. By investigating these effects, researchers aim to unravel the neural circuits and hormonal pathways involved in energy intake regulation. Such studies contribute to a deeper understanding of obesity and related disorders, offering potential avenues for the development of appetite-modulating interventions.

Beta Cell Function and Survival: The peptide is also instrumental in studies focused on pancreatic beta cell health, proliferation, and apoptosis. Through in vitro and in vivo experiments, scientists use GLP-1 (7-36) amide to assess its protective and regenerative effects on beta cells exposed to metabolic or oxidative stress. These investigations are crucial for identifying factors that promote beta cell survival and for developing strategies to preserve or restore endogenous insulin production in diabetes research. The peptide's ability to mimic physiological incretin effects makes it a preferred choice for these applications.

Cardiovascular and Renal Physiology: Beyond metabolic regulation, GLP-1 (7-36) amide is increasingly employed in studies exploring its impact on cardiovascular and renal systems. Research has demonstrated that the peptide can modulate heart rate, blood pressure, and renal function through direct and indirect mechanisms. By leveraging its receptor-mediated actions, scientists are able to investigate the interplay between metabolic and cardiovascular health, as well as the potential protective effects of incretin signaling on organ function. These multifaceted applications underscore the scientific value of GLP-1 (7-36) amide in advancing our understanding of complex physiological processes and their relevance to human health.

Long-term Storage Conditions
Soluble to 1 mg/ml in water; 10 mM in DMSO
Shipping Condition
Shipped at room temperature
InChI
InChI=1S/C149H226N40O45/c1-17-76(10)119(146(232)167-80(14)126(212)175-104(60-86-63-159-91-36-25-24-35-89(86)91)136(222)177-100(56-73(4)5)137(223)186-117(74(6)7)144(230)174-93(37-26-28-52-150)128(214)160-65-110(197)168-92(122(154)208)39-30-54-158-149(155)156)188-138(224)102(57-83-31-20-18-21-32-83)178-133(219)98(47-51-115(204)205)173-132(218)94(38-27-29-53-151)170-124(210)78(12)164-123(209)77(11)166-131(217)97(44-48-109(153)196)169-111(198)66-161-130(216)96(46-50-114(202)203)172-134(220)99(55-72(2)3)176-135(221)101(59-85-40-42-88(195)43-41-85)179-141(227)106(68-190)182-143(229)108(70-192)183-145(231)118(75(8)9)187-140(226)105(62-116(206)207)180-142(228)107(69-191)184-148(234)121(82(16)194)189-139(225)103(58-84-33-22-19-23-34-84)181-147(233)120(81(15)193)185-112(199)67-162-129(215)95(45-49-113(200)201)171-125(211)79(13)165-127(213)90(152)61-87-64-157-71-163-87/h18-25,31-36,40-43,63-64,71-82,90,92-108,117-121,159,190-195H,17,26-30,37-39,44-62,65-70,150-152H2,1-16H3,(H2,153,196)(H2,154,208)(H,157,163)(H,160,214)(H,161,216)(H,162,215)(H,164,209)(H,165,213)(H,166,217)(H,167,232)(H,168,197)(H,169,198)(H,170,210)(H,171,211)(H,172,220)(H,173,218)(H,174,230)(H,175,212)(H,176,221)(H,177,222)(H,178,219)(H,179,227)(H,180,228)(H,181,233)(H,182,229)(H,183,231)(H,184,234)(H,185,199)(H,186,223)(H,187,226)(H,188,224)(H,189,225)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H4,155,156,158)/t76-,77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,117-,118-,119-,120-,121-/m0/s1
InChI Key
DTHNMHAUYICORS-KTKZVXAJSA-N
Canonical SMILES
[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicecGMP Peptide ServicePeptide Analysis ServicesPeptide Modification ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers