Glucagon-like peptide 1 (7-36) amide (human, rat)

Glucagon-Like Peptide 1 (7-36) Amide is a potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells.

Online Inquiry

CAT#10-101-265
CAS107444-51-9
Synonyms/AliasGLP-1; GLP-1 (7-36) amide; Insulinotropin
M.F/FormulaC149H226N40O45
M.W/Mr.3297.67
SequenceOne Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (Modifications: Arg-30 = C-terminal amide)
Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
ActivityDisplays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.
Quick Inquiry
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

 Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...

 Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

 BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...

 Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.