Glucagon-like peptide 1 (7-36) amide (human, rat)

Glucagon-Like Peptide 1 (7-36) Amide is a potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Glucagon-like peptide 1 (7-36) amide (human, rat)(CAS 107444-51-9)

CAT No: 10-101-265

CAS No:107444-51-9

Synonyms/Alias:107444-51-9;Glucagon-like peptide-I(7-36) amide;Glucagon-like Peptide 1 (7-36) amide;GLP-1(7-36);GLP-1(7-36), amide;GLP-17-3;Insulinotropin (human);Rat GLP-I(7-36)amide;UNII-0JS9125PIZ;GLP-1 (7-36) amide;Glp-I (7-36);MKC 253;Glucagon-like peptide I (7-36);Glucagon-like peptide 1 (7-36);Human glucagon-like peptide-1-(7-36) amide;0JS9125PIZ;AKOS024456935;GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt;Glucagon-like Peptide-1 (7-36) Amide;DA-53583;FG109975;GLP-1-(7-36);TS-08934;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H226N40O45
M.W/Mr.
3297.6
Sequence
One Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Activity
Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Glucagon-like peptide 1 (7-36) amide (human, rat) is a biologically active peptide fragment derived from the proglucagon sequence, representing the primary incretin hormone responsible for potentiating glucose-dependent insulin secretion. As a key regulator of metabolic homeostasis, this peptide exerts multifaceted roles in endocrine signaling, energy balance, and cellular communication, making it highly relevant for metabolic research. The (7-36) amide form is the predominant circulating isoform in both humans and rodents, exhibiting resistance to enzymatic degradation and high affinity for GLP-1 receptors. Its conserved sequence and robust bioactivity have established it as a foundational tool for dissecting peptide hormone function, receptor pharmacology, and intracellular signaling pathways in both basic and translational research contexts.

Receptor Pharmacology Studies: GLP-1 (7-36) amide is extensively employed to investigate the pharmacodynamics and signal transduction mechanisms of the glucagon-like peptide-1 receptor (GLP-1R). By serving as a high-affinity, physiologically relevant agonist, it enables detailed characterization of receptor-ligand interactions, downstream cAMP-mediated pathways, and G protein-coupled receptor (GPCR) modulation. These studies are critical for elucidating the molecular basis of incretin signaling and for the development of receptor-targeted compounds.

Metabolic Regulation Research: As a central modulator of insulin secretion and glucose homeostasis, this peptide fragment is widely used in studies exploring pancreatic β-cell function, glucose-stimulated insulin release, and islet physiology. Researchers utilize it to probe the mechanisms underlying nutrient-induced hormone secretion and to model metabolic responses in both in vitro and ex vivo systems. Its application provides valuable insights into the cellular processes governing energy metabolism and the regulation of glycemic control.

Peptide Structure-Activity Relationship (SAR) Analysis: The defined amino acid sequence and C-terminal amidation of GLP-1 (7-36) amide make it an ideal template for structure-activity relationship studies. By introducing targeted modifications or generating analogues, scientists can systematically assess the impact of specific residues on receptor binding affinity, bioactivity, and peptide stability. Such analyses are instrumental in guiding rational peptide design and optimizing the pharmacological properties of GLP-1-based molecules.

Cellular Signaling Pathway Dissection: The peptide's ability to activate multiple intracellular signaling cascades, including those involving PKA, PI3K, and MAPK, positions it as a valuable reagent for dissecting the downstream effects of GPCR activation. Investigators employ it to delineate the interplay between metabolic hormones and intracellular effectors, thereby advancing the understanding of cellular communication networks and cross-talk between signaling pathways in various tissues.

Peptide Delivery and Degradation Studies: Owing to its physiological relevance and susceptibility to enzymatic cleavage by dipeptidyl peptidase-4 (DPP-4), GLP-1 (7-36) amide is frequently used in research focused on peptide stability, degradation kinetics, and delivery strategies. These studies inform the design of stabilized analogues, peptide delivery systems, and DPP-4 inhibition assays, supporting the broader field of peptide therapeutics and biopharmaceutical development.

Long-term Storage Conditions
Soluble to 1 mg/ml in water; 10 mM in DMSO
Shipping Condition
Shipped at room temperature
InChI
InChI=1S/C149H226N40O45/c1-17-76(10)119(146(232)167-80(14)126(212)175-104(60-86-63-159-91-36-25-24-35-89(86)91)136(222)177-100(56-73(4)5)137(223)186-117(74(6)7)144(230)174-93(37-26-28-52-150)128(214)160-65-110(197)168-92(122(154)208)39-30-54-158-149(155)156)188-138(224)102(57-83-31-20-18-21-32-83)178-133(219)98(47-51-115(204)205)173-132(218)94(38-27-29-53-151)170-124(210)78(12)164-123(209)77(11)166-131(217)97(44-48-109(153)196)169-111(198)66-161-130(216)96(46-50-114(202)203)172-134(220)99(55-72(2)3)176-135(221)101(59-85-40-42-88(195)43-41-85)179-141(227)106(68-190)182-143(229)108(70-192)183-145(231)118(75(8)9)187-140(226)105(62-116(206)207)180-142(228)107(69-191)184-148(234)121(82(16)194)189-139(225)103(58-84-33-22-19-23-34-84)181-147(233)120(81(15)193)185-112(199)67-162-129(215)95(45-49-113(200)201)171-125(211)79(13)165-127(213)90(152)61-87-64-157-71-163-87/h18-25,31-36,40-43,63-64,71-82,90,92-108,117-121,159,190-195H,17,26-30,37-39,44-62,65-70,150-152H2,1-16H3,(H2,153,196)(H2,154,208)(H,157,163)(H,160,214)(H,161,216)(H,162,215)(H,164,209)(H,165,213)(H,166,217)(H,167,232)(H,168,197)(H,169,198)(H,170,210)(H,171,211)(H,172,220)(H,173,218)(H,174,230)(H,175,212)(H,176,221)(H,177,222)(H,178,219)(H,179,227)(H,180,228)(H,181,233)(H,182,229)(H,183,231)(H,184,234)(H,185,199)(H,186,223)(H,187,226)(H,188,224)(H,189,225)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H4,155,156,158)/t76-,77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,117-,118-,119-,120-,121-/m0/s1
InChI Key
DTHNMHAUYICORS-KTKZVXAJSA-N
Canonical SMILES
[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOEpitope Mapping ServicesPeptide Modification ServicescGMP Peptide ServicePeptide Analysis ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers