CAT# | G01019 |
M.F/Formula | C206H326N56O64S1 |
M.W/Mr. | 4643.3 |
Sequence | ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 |
Length | 41 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G01013 | Galanin (1 - 13) - Neuropeptide Y (25 - 36), amide, M32 | Inquiry | ||
G01011 | Galanin (1-13)-Spantide I | Inquiry | ||
G01018 | Preprogalanin 28-67, rat | Inquiry | ||
G01034 | Galanin-Like Peptide (human) | Inquiry | ||
G01035 | Galnon | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...