Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C149H246N44O42S |
M.W/Mr. | 3357.93 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
Length | 29 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
3. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.