GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1403

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
3850.31
Sequence
One Letter Code: GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
three Letter Code: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a synthetic peptide sequence that serves as a valuable tool in the field of biochemical and molecular research. Characterized by its defined amino acid arrangement, this peptide offers a precise model for studying peptide-protein interactions, signal transduction mechanisms, and structure-activity relationships. Its unique sequence composition enables researchers to investigate various aspects of peptide chemistry, including conformational dynamics, binding affinities, and post-translational modification sites. The compound's versatility makes it an important asset for laboratories engaged in peptide-based assay development, functional analysis, and advanced proteomics.

Peptide mapping: As a well-defined synthetic peptide, GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is frequently employed in peptide mapping studies to elucidate protein structure and function. By serving as a reference or substrate in mass spectrometry-based proteomic workflows, it aids in the identification and characterization of cleavage patterns, post-translational modifications, and sequence-specific interactions. This application is particularly critical for validating analytical methods and ensuring the accuracy of protein identification in complex biological samples.

Protein interaction studies: The peptide's sequence can be used as a probe to assess binding affinities and specificities with target proteins, antibodies, or other biomolecules. Through techniques such as surface plasmon resonance, isothermal titration calorimetry, or pull-down assays, researchers can quantify and characterize molecular interactions that are fundamental to understanding signaling pathways, regulatory mechanisms, or epitope mapping. These insights are essential for advancing knowledge in fields such as cell signaling, immunology, and drug discovery.

Assay development: In the development of biochemical assays, this peptide serves as a calibrator, substrate, or control to optimize detection systems and validate assay performance. Its defined structure allows for reproducible results in enzyme activity measurements, immunoassays, or high-throughput screening platforms. The use of such a peptide standard enhances assay sensitivity, specificity, and robustness, ultimately supporting the generation of reliable experimental data.

Structural biology research: The sequence of GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is suitable for structural studies, including nuclear magnetic resonance (NMR) spectroscopy and X-ray crystallography. By providing a model system with a known primary structure, it enables detailed analysis of secondary and tertiary conformations, folding kinetics, and stability under various physicochemical conditions. Such studies contribute to a deeper understanding of peptide folding principles and the role of specific residues in maintaining structural integrity.

Peptide synthesis optimization: The compound is also valuable for method development and process optimization in solid-phase peptide synthesis (SPPS). By using this sequence as a test case, researchers can evaluate coupling efficiency, deprotection protocols, and purification strategies. Insights gained from these optimization studies help refine synthetic methodologies, improve yield and purity, and facilitate the production of more complex peptide constructs for downstream applications.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Synthesis ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide CDMOEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers