Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
Activity | Antibacterial |
Host Chemicals | Homo sapiens |
Length | 41 |
SwissProt ID | O15263 |
1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.