CAT# | AF1861 |
Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Activity | Antibacterial |
Host Chemicals | Homo sapiens | Length | 30 | SwissProt ID | P59665 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF933 | MicrocinJ25 | Inquiry | ||
AF2890 | Bacteriocin bavaricin-A | Inquiry | ||
AF2057 | Neutrophil cationic peptide 2 precursor | Inquiry | ||
AF1966 | Lf-CATH1 | Inquiry | ||
AF223 | Temporin-1Oc | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...