Home > Product > Antimicrobial Peptides > Hydramacin-1

Antimicrobial Peptides

Hydramacin-1

Price Inquiry
CAT#
AF3337
Sequence
QIVDCWETWSRCTKWSQGGTGTLWKSCNDRCKELGRKRGQCEEKPSRCPLSKKAWTCICY
Host Chemicals
Hydra magnipapillata
Length
60
Activity
Gram+ & Gram-,
SwissProt ID
PDB ID: 2K35

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.