CAT# | AF2036 |
Sequence | GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN |
Activity | Antimicrobial |
Host Chemicals | Hybanthus floribundus E | Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1273 | Brevinin-1CHa | Inquiry | ||
AF1637 | Lycotoxin-2 | Inquiry | ||
AF1906 | Cycloviolacin H4 | Inquiry | ||
AF2791 | Casocidin-1 | Inquiry | ||
AF1267 | Brevinin-1Yb | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...