Home > Product > Antimicrobial Peptides > Hyphancin-3D

Antimicrobial Peptides

Hyphancin-3D

Price Inquiry
CAT#
AF2463
Sequence
RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKAL
Host Chemicals
Hyphantria cunea
Length
35
Activity
Antibacterial
SwissProt ID
P50720

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.