Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKAL |
Activity | Antibacterial |
Host Chemicals | Hyphantria cunea |
Length | 35 |
SwissProt ID | P50720 |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Myotropic activity of allatostatins in tenebrionid beetles
3. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.