Intermedin (rat) trifluoroacetate salt

Intermedin (rat) trifluoroacetate salt is a calcitonin-family peptide used to explore species-specific receptor recognition and helical amphipathic motifs. The sequence supports conformational studies in solution and comparative folding analyses with human analogs. Trifluoroacetate counterions aid solubility and handling in biochemical assays. Applications include structural modeling, ligand-receptor mapping, and peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: I04005

CAS No:1816940-00-7

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₂₆H₃₆₁N₇₅O₆₄S₂
M.W/Mr.
5216.95
Sequence
One Letter Code: PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH₂
three Letter Code: H-Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Synthesis ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide CDMOPeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers