Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₂₆H₃₆₁N₇₅O₆₄S₂ |
M.W/Mr. | 5216.95 |
Sequence | One Letter Code: PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH₂ three Letter Code: H-Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg-Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond) |
Source# | Synthetic |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.