Keywords Search Google Search Search

Kelch 2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A40003
Sequence	IYMYGGKIDSTGNVTNELRVFHIHNESWVLLTPKAKEQYAVVGHSAHI

CAT#	Product Name	Inquiry
X09522	PM_18556208	Inquiry
F1304	For-Ala-Ala-Ala-OH	Inquiry
X17563	UP_O44662	Inquiry
X02917	PM_10586077	Inquiry
E02002	Eglin c (42-45)-methyl ester · HCl	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Broad-spectrum antibacterial activity of PR 39

PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...

Desmopressin

Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...

Glucagon like peptide-1 (GLP-1)

GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...

Function of basic fibroblast growth factor in skin

Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: