Home > Product > Antimicrobial Peptides > Lactococcin Q alpha

Antimicrobial Peptides

Lactococcin Q alpha

Price Inquiry
CAT#
AF2796
Sequence
SIWGDIGQGVGKAAYWVGKAMGNMSDVNQASRINRKKKH
Host Chemicals
Lactococcus lactis QU 4
Length
39
Activity
Antibacterial
SwissProt ID
Q1JV79

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.