CAT# | AF2391 |
Sequence | TAGPAIRASVKQCQKTLKATRLFTVSCKGKNGCK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...