CAT# | L02001 |
M.F/Formula | C142H237N45O39S7 |
M.W/Mr. | 3423.19 |
Sequence | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...