Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | TITLSTCAILSKPLGNNGYLCTVTKECMPSCN |
Activity | Antibacterial |
Length | 32 |
2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
5. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.