Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C154H257N49O40S1 |
M.W/Mr. | 3467.1 |
Sequence | KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 |
Length | 28 |
1. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.