Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN |
Length | 43 |
Modifications | Disulfide bond(3) |
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.