Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR |
Activity | Antimicrobial |
Host Chemicals | Mytilus galloprovincialis |
Length | 43 |
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.