Nesfatin-1 (24-53), human

Nesfatin-1 was recently identified as an anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 has been linked to anxiety and stress.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: N01004

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
3685.3
Sequence
One Letter Code: PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2
Three Letter Code: Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2
References
1. Feijóo-Bandín S., et.al., Endocrinology 154 (12), 4757-4767 (2013)
2. Vas S., et.al., PLOS 8 (4), 1-10 (2013)
3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide CDMOPeptide Analysis ServicesEpitope Mapping ServicesPeptide Modification ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers