NT1-20 is a 20-residue peptide fragment enriched in polar, cationic, and hydrophobic residues that support complex folding behavior. Researchers employ it to map receptor-binding hotspots and analyze structural transitions. Applications include neuropeptide-motif research, structure-function analysis, and analog development.
CAT No: R2822
Synonyms/Alias:AS-010; NT1 “20; GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA; NT1-20
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Cationic cell-penetrating peptides are potent furin inhibitors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.