NT1-20 is a 20-residue peptide fragment enriched in polar, cationic, and hydrophobic residues that support complex folding behavior. Researchers employ it to map receptor-binding hotspots and analyze structural transitions. Applications include neuropeptide-motif research, structure-function analysis, and analog development.
CAT No: R2822
Synonyms/Alias:AS-010; NT1 “20; GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA; NT1-20
NT1-20 is a specialized carbohydrate compound recognized for its unique structural properties and versatility in scientific research. As a synthetic oligosaccharide, NT1-20 features a well-defined sequence of monosaccharide units, which enables precise interaction with various biological molecules. Its robust stability and high solubility in aqueous environments make it an attractive tool for experimental applications where reproducibility and consistency are paramount. Researchers value NT1-20 for its ability to mimic naturally occurring carbohydrate motifs, thereby facilitating the exploration of glycan-related mechanisms in diverse biological systems. The compound's compatibility with a range of analytical and preparative techniques further enhances its utility across multiple disciplines.
Glycobiology Research: NT1-20 is widely employed in glycobiology research to elucidate the roles of specific carbohydrate structures in cellular recognition and signaling. By serving as a model oligosaccharide, it allows scientists to dissect the molecular basis of glycan-mediated interactions between cells and proteins. This application is critical for advancing our understanding of how carbohydrates influence cell communication, adhesion, and immune responses, ultimately contributing to the broader field of glycoscience.
Lectin Binding Studies: The compound is frequently used in lectin binding assays, where it acts as a defined ligand to probe the specificity and affinity of various lectins. Researchers utilize NT1-20 to map lectin binding sites and to characterize the molecular determinants that govern carbohydrate-protein recognition. Such studies are essential for identifying potential targets for diagnostic and therapeutic interventions, as well as for developing glycan-based detection platforms.
Enzyme Substrate Analysis: NT1-20 serves as a valuable substrate in enzymatic assays designed to investigate the activity and selectivity of glycosidases and glycosyltransferases. By providing a consistent and structurally characterized substrate, it enables detailed kinetic and mechanistic studies of carbohydrate-active enzymes. These insights are instrumental for enzyme engineering, inhibitor design, and the development of synthetic biology applications involving glycan modification.
Biomaterials Development: In the field of biomaterials, NT1-20 is utilized to functionalize surfaces and scaffolds with carbohydrate motifs, thereby modulating cell-material interactions. Researchers leverage its well-defined structure to create bioactive coatings that promote specific cellular responses or to engineer hydrogels with tailored biological properties. Such approaches are vital for advancing tissue engineering, regenerative medicine, and the design of smart biomaterials.
Analytical Method Validation: NT1-20 plays a significant role in the validation and calibration of analytical techniques used for carbohydrate detection and quantification. Laboratories employ it as a reference standard in chromatographic, spectroscopic, and mass spectrometric methods, ensuring the accuracy and reliability of glycan analysis workflows. Its consistent performance as a calibration tool supports quality control and method development in both academic and industrial settings.
Synthetic carbohydrate compounds like NT1-20 continue to drive innovation in fundamental and applied research. By enabling precise studies of glycan interactions, supporting the development of advanced biomaterials, and ensuring robust analytical workflows, NT1-20 stands as a cornerstone in the expanding field of carbohydrate science. Its multifaceted applications not only deepen scientific understanding but also pave the way for new technologies and methodologies that harness the power of glycoscience.
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.