NT1-20

NT1-20 is a 20-residue peptide fragment enriched in polar, cationic, and hydrophobic residues that support complex folding behavior. Researchers employ it to map receptor-binding hotspots and analyze structural transitions. Applications include neuropeptide-motif research, structure-function analysis, and analog development.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2822

Synonyms/Alias:AS-010; NT1 “20; GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA; NT1-20

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C150H265N55O47S2
M.W/Mr.
3655.22
Sequence
One Letter Code:GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA
Three Letter Code:H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH

NT1-20 is a synthetic peptide compound designed for advanced biochemical and molecular biology research applications. As a custom-sequence peptide, NT1-20 offers precise control over amino acid composition, enabling researchers to investigate structure-activity relationships, protein-protein interactions, and peptide-mediated signaling pathways. Its well-defined sequence and high reproducibility make it a valuable tool for probing specific biological mechanisms and facilitating the development of peptide-based assays. The compound's versatility supports a broad range of experimental approaches in both basic and applied sciences, making it a key reagent in peptide research and functional studies.

Peptide functional studies: NT1-20 serves as a powerful probe for elucidating the biological roles of specific peptide motifs within cellular systems. By introducing it into in vitro or ex vivo models, researchers can assess its influence on signaling cascades, receptor binding, or enzymatic activities. Such studies help clarify the molecular basis of peptide-mediated processes, providing insights into protein interactions, cellular communication, and regulatory networks. The ability to systematically modify the sequence further allows dissection of structure-function relationships, advancing understanding of peptide specificity and activity.

Protein interaction mapping: The defined sequence of NT1-20 makes it ideally suited for mapping protein-protein or protein-peptide interactions using techniques such as pull-down assays, surface plasmon resonance, or co-immunoprecipitation. By immobilizing the peptide or using it as a soluble ligand, researchers can identify binding partners, characterize interaction affinities, and delineate the molecular determinants of specificity. These studies are instrumental in decoding cellular signaling mechanisms and in validating targets for drug discovery or synthetic biology projects.

Peptide synthesis optimization: NT1-20 can be used as a model substrate to optimize solid-phase peptide synthesis protocols, purification strategies, and analytical characterization methods. Its sequence complexity and physicochemical properties provide a relevant test case for evaluating coupling efficiencies, protecting group strategies, and chromatographic separation techniques. Such optimization is critical for laboratories engaged in custom peptide production, quality control, or method development, ensuring reproducibility and scalability of peptide manufacturing processes.

Assay development: The unique properties of NT1-20 enable its incorporation into a variety of biochemical and biophysical assay platforms. As a reference standard or functional component, it can be utilized in enzyme activity assays, competitive binding formats, or high-throughput screening systems. Its reproducibility and defined sequence facilitate assay calibration, validation, and benchmarking, supporting robust and quantitative measurement of biological activities or molecular interactions in research and industrial settings.

Epitope identification and antibody generation: NT1-20's sequence can be leveraged for epitope mapping studies or as an immunogen in antibody production workflows. By presenting a specific peptide segment, it enables the identification of antibody-binding sites, assessment of cross-reactivity, and generation of sequence-specific monoclonal or polyclonal antibodies. These applications are crucial for developing targeted detection reagents, advancing immunoassay design, and supporting the characterization of protein antigens in diverse research contexts.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Analysis ServicesPeptide Modification ServicesPeptide Synthesis ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers