Home > Product > Antimicrobial Peptides > Odorranain-k1 antimicrobial peptide

Antimicrobial Peptides

Odorranain-k1 antimicrobial peptide

Price Inquiry
CAT#
AF2772
Sequence
GLFTLIKGAAKLIGKTVPKKQARLGMNLWLVKLPTNVKT
Host Chemicals
Odorrana grahami
Length
39
Activity
Antibacterial, Antifungal
SwissProt ID
A6MBN8

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.