Home > Product > Antimicrobial Peptides > Omwaprin

Antimicrobial Peptides

CAT#
AF3261
Sequence
KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG
Host Chemicals
venom, Oxyuranus microlepidotus
Length
50
Activity
Gram+,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.