Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | IRNSLTCRFNFGICLPKRCPGRMRQIGTCF |
Activity | Antimicrobial |
Host Chemicals | Cervus elaphus |
Length | 30 |
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.