CAT# | P08008 |
M.F/Formula | C142H224N40O39S |
M.W/Mr. | 3147.65 |
Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
Length | 27 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P08001 | [Arg14,20,21, Leu16] PACAP (1-27), human, ovine, rat | Inquiry | ||
P08014 | PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | Inquiry | ||
P08011 | PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) | Inquiry | ||
P08002 | [Des-Gln16] PACAP (6-27), human, ovine, rat | Inquiry | ||
P08013 | PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...
Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...