Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 5266.4 |
Sequence | YGWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 |
Length | 50 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.