Pancreastatin [Tyr0], porcine

Pancreastatin [Tyr0], porcine incorporates an N-terminal tyrosine, adding spectroscopic utility and a site for labeling. The modification preserves regions essential for structural integrity and partner recognition. Researchers use this analog to track peptide folding and binding. Its tailored sequence supports fluorescence and affinity-based experiments.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P01006

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
5266.4
Sequence
YGWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2
Length
50

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Modification ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers