Visit Us at the Neuroscience 2024 in McCormick Place, Chicago from Oct 5-9, 2024 (Booth number #351).

Parathyroid Hormone (1-34), rat

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03053
M.F/Formula	C180H291N55O48S2
M.W/Mr.	4057.8
Sequence	One Letter Code: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF three Letter Code: H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH (trifluoroacetate salt)

CAT#	Product Name	Inquiry
P03020	(Tyr52)-pTH (52-84) (human)	Inquiry
P03007	pTH (64-84) (human)	Inquiry
P03041	Parathyroid Hormone (1-38), human	Inquiry
P03035	[Tyr1] Parathyroid Hormone (1-34), human	Inquiry
P03050	(Cys8)-pTH (1-8) (human)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

The mechanism and function of acetyl tetrapeptide-2 in human skin

Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...

Palmitoyl pentapeptide-4

An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

Comprehensive effect of angiotensin II acetate

Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Length	34
Storage	-20 ± 5 °C