Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C180H291N55O48S2 |
M.W/Mr. | 4057.8 |
Sequence | One Letter Code: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF three Letter Code: H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH (trifluoroacetate salt) |
Source# | Synthetic |
Length | 34 |
3. Cationic cell-penetrating peptides are potent furin inhibitors
5. Myotropic activity of allatostatins in tenebrionid beetles
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.