CAT# | AF2568 |
Sequence | DVKGMKKAIKGILDCVIEKGYDKLAAKLKKVIQQLWE |
Activity | Antimicrobial |
Host Chemicals | Myrmecia pilosula | Length | 37 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3328 | Acanthaporin | Inquiry | ||
AF2357 | mCRAMP | Inquiry | ||
AF972 | Nigrosin-OG20 , nigrocin-2GRa , Grahamin-1, nigrosin-OG17 | Inquiry | ||
AF1903 | Cycloviolacin Y5 | Inquiry | ||
AF3081 | Piscidin 4 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...