Home > Product > Antimicrobial Peptides > PP113

Antimicrobial Peptides

CAT#
AF2939
Sequence
GKWGWIYITILFADVGGFKSSRHPEERRVQERRFKRITRGPD
Host Chemicals
Pteromalus puparum
Length
42
Activity
Antibacterial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.