(Pro3)-Gastric Inhibitory Polypeptide (human)

H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH is a long, multi-domain peptide containing aromatic, hydrophobic, acidic, and basic residues. Researchers explore its hydrogen-bond networks, conformational transitions, and solvent behavior. The extended chain supports studies of modular folding and binding interactions. Applications include structural-biophysics research, motif-function mapping, and peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
(Pro3)-Gastric Inhibitory Polypeptide (human)(CAS 299898-52-5)

CAT No: R2540

CAS No:299898-52-5

Synonyms/Alias:H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH;FP110167;(Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt;299898-52-5;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C226H338N60O64S
M.W/Mr.
4952
Sequence
One Letter Code:YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Three Letter Code:H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChI
InChI=1S/C226H338N60O64S/c1-21-114(11)181(284-216(339)165(108-288)277-201(324)150(89-126-62-66-132(292)67-63-126)263-210(333)163(100-179(308)309)273-215(338)164(107-287)278-221(344)183(116(13)23-3)282-213(336)152(88-124-48-29-26-30-49-124)274-223(346)185(121(18)289)279-175(301)106-245-217(340)166-59-45-82-286(166)225(348)120(17)250-189(312)135(232)86-125-60-64-131(291)65-61-125)219(342)249-119(16)188(311)253-146(76-83-351-20)197(320)271-160(97-176(302)303)208(331)257-142(58-39-44-81-231)198(321)281-182(115(12)22-2)220(343)275-156(93-130-104-241-110-247-130)204(327)259-144(69-73-168(234)294)195(318)258-145(70-74-169(235)295)196(319)270-161(98-177(304)305)209(332)264-151(87-123-46-27-25-28-47-123)212(335)280-180(113(9)10)218(341)276-158(95-172(238)298)207(330)265-154(91-128-102-243-137-53-34-32-51-134(128)137)203(326)262-149(85-112(7)8)200(323)261-148(84-111(5)6)199(322)248-118(15)187(310)252-143(68-72-167(233)293)194(317)254-138(54-35-40-77-227)190(313)244-105-174(300)251-139(55-36-41-78-228)191(314)255-140(56-37-42-79-229)193(316)268-157(94-171(237)297)206(329)272-162(99-178(306)307)211(334)266-153(90-127-101-242-136-52-33-31-50-133(127)136)202(325)256-141(57-38-43-80-230)192(315)267-155(92-129-103-240-109-246-129)205(328)269-159(96-173(239)299)214(337)283-184(117(14)24-4)222(345)285-186(122(19)290)224(347)260-147(226(349)350)71-75-170(236)296/h25-34,46-53,60-67,101-104,109-122,135,138-166,180-186,242-243,287-292H,21-24,35-45,54-59,68-100,105-108,227-232H2,1-20H3,(H2,233,293)(H2,234,294)(H2,235,295)(H2,236,296)(H2,237,297)(H2,238,298)(H2,239,299)(H,240,246)(H,241,247)(H,244,313)(H,245,340)(H,248,322)(H,249,342)(H,250,312)(H,251,300)(H,252,310)(H,253,311)(H,254,317)(H,255,314)(H,256,325)(H,257,331)(H,258,318)(H,259,327)(H,260,347)(H,261,323)(H,262,326)(H,263,333)(H,264,332)(H,265,330)(H,266,334)(H,267,315)(H,268,316)(H,269,328)(H,270,319)(H,271,320)(H,272,329)(H,273,338)(H,274,346)(H,275,343)(H,276,341)(H,277,324)(H,278,344)(H,279,301)(H,280,335)(H,281,321)(H,282,336)(H,283,337)(H,284,339)(H,285,345)(H,302,303)(H,304,305)(H,306,307)(H,308,309)(H,349,350)/t114-,115-,116-,117-,118-,119-,120-,121+,122+,135-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,180-,181-,182-,183-,184-,185-,186-/m0/s1
InChI Key
FYUWJDFZJSKUGR-STMGAEMMSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicescGMP Peptide ServicePeptide CDMOPeptide Analysis ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers