Proadrenomedullin (45-92), human

Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1629

CAS No:166798-69-2

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₁₅H₃₅₉N₆₇O₇₃S₂
M.W/Mr.
5114.76
Sequence
One Letter Code: ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV
three Letter Code: Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val

Proadrenomedullin (45-92), human, is a synthetic peptide fragment derived from the C-terminal region of the proadrenomedullin precursor. As a bioactive peptide, it represents a segment of the larger adrenomedullin precursor protein, which is involved in a variety of physiological processes, including vascular regulation, cell signaling, and homeostasis. The (45-92) fragment is of particular interest in biochemical and pharmacological research due to its distinct functional properties compared to the full-length peptide, offering a valuable tool for dissecting the roles of proadrenomedullin-derived peptides in cellular and molecular pathways. Its sequence specificity and structural characteristics make it suitable for in vitro and in vivo studies focused on peptide hormone biology, receptor interactions, and peptide processing mechanisms.

Peptide signaling research: As a representative fragment of proadrenomedullin, this compound is frequently employed in studies investigating the signaling pathways activated by peptide hormones. Researchers utilize it to elucidate the downstream effects of adrenomedullin precursors on cellular receptors and to characterize the molecular mechanisms by which these peptides influence vascular tone, endothelial cell function, and intercellular communication. By providing a selective tool for modulating peptide-receptor interactions, the (45-92) fragment enables precise evaluation of signaling cascades distinct from those triggered by the mature adrenomedullin peptide.

Receptor binding assays: The unique sequence of proadrenomedullin (45-92) allows for detailed receptor binding studies, particularly in the context of identifying and characterizing binding affinities to specific G protein-coupled receptors and related peptide-binding proteins. Utilizing radiolabeled or fluorescently tagged versions of the peptide, researchers can quantify binding kinetics, determine receptor specificity, and map interaction domains. Such investigations are critical for understanding the molecular determinants of ligand-receptor selectivity and for the development of novel receptor modulators in basic research.

Peptide processing studies: The peptide serves as an important substrate in biochemical assays designed to explore the enzymatic cleavage and maturation of prohormone precursors. By tracing the conversion of proadrenomedullin fragments to bioactive peptides, scientists gain insights into the regulation of peptide biosynthesis, post-translational modifications, and the role of proteolytic enzymes in peptide hormone maturation. These studies have broad implications for understanding peptide homeostasis and the physiological regulation of vasoactive peptides.

Vascular biology research: Due to its origin from a precursor involved in vascular homeostasis, proadrenomedullin (45-92) is applied in experimental models assessing the modulation of vascular smooth muscle cell activity, endothelial barrier function, and angiogenic responses. The peptide fragment allows investigators to dissect the contribution of specific domains of proadrenomedullin to the regulation of vascular tone and permeability, supporting detailed mechanistic studies of cardiovascular regulation at the molecular level.

Structure-activity relationship (SAR) analysis: The defined amino acid sequence of the (45-92) fragment provides a foundation for SAR studies aimed at pinpointing functional motifs within the proadrenomedullin precursor. By synthesizing and testing analogs or truncated versions of the peptide, researchers can identify residues critical for biological activity, receptor engagement, and stability. These insights are instrumental for the rational design of peptide-based probes and for advancing the understanding of structure-function relationships in peptide hormone families.

Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Modification ServicesPeptide Analysis ServicesPeptide Synthesis ServicesEpitope Mapping ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers