Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products.
CAT# | R1629 |
CAS | 166798-69-2 |
M.F/Formula | C₂₁₅H₃₅₉N₆₇O₇₃S₂ |
M.W/Mr. | 5114.76 |
Sequence | One Letter Code: ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV three Letter Code: Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...