Prokineticin 2 Isoform 2 (human)

Prokineticin 2 Isoform 2 (human) trifluoroacetate salt is a secreted signaling peptide engaged in studies of circadian regulation and cellular communication. Structural motifs enable high-affinity interactions with prokineticin receptors, making it valuable in pathway characterization. Researchers explore its role in cell migration and tissue signaling dynamics. The salt form supports consistent solubility in biochemical workflows.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: N1951

CAS No:423206-00-2

Synonyms/Alias:Prokineticin 2 Isoform 2 (human) trifluoroacetate salt;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃
M.W/Mr.
8792.55
Sequence
One Letter Code: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
three Letter Code: H-Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys-OH trifluoroacetate salt (Disulfide bonds, air oxidized)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide Synthesis ServicesPeptide CDMOPeptide Nucleic Acids SynthesisCustom Conjugation ServiceEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers