CAT# | P13002 |
M.F/Formula | C157H244N54O41S |
M.W/Mr. | 3576.1 |
Sequence | SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 |
Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P13001 | Prolactin-Releasing Peptide (1-31), rat | Inquiry | ||
P13004 | Prolactin Releasing Peptide (12-31), bovine | Inquiry | ||
P13006 | Prolactin Releasing Peptide (12-31), rat | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...
GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...